Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2609316..2609866 Replicon chromosome
Accession NZ_LR778152
Organism Escherichia coli isolate SC477

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag H1D09_RS12780 Protein ID WP_001160966.1
Coordinates 2609316..2609630 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag H1D09_RS12785 Protein ID WP_000125566.1
Coordinates 2609633..2609866 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D09_RS12755 2604991..2606277 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
H1D09_RS12760 2606277..2607266 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
H1D09_RS12765 2607263..2608084 + 822 WP_001065366.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
H1D09_RS12770 2608087..2608464 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
H1D09_RS12775 2608471..2609319 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
H1D09_RS12780 2609316..2609630 - 315 WP_001160966.1 CcdB family protein Toxin
H1D09_RS12785 2609633..2609866 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
H1D09_RS12790 2609952..2610431 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
H1D09_RS12795 2610623..2612485 - 1863 WP_000377117.1 glutathione-regulated potassium-efflux system protein KefC -
H1D09_RS12800 2612478..2613008 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
H1D09_RS12805 2613116..2614447 - 1332 WP_175058590.1 MFS transporter -
H1D09_RS12810 2614506..2614793 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T289289 WP_001160966.1 NZ_LR778152:c2609630-2609316 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT289289 WP_000125566.1 NZ_LR778152:c2609866-2609633 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References