Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2406077..2406702 | Replicon | chromosome |
| Accession | NZ_LR778151 | ||
| Organism | Escherichia coli isolate SC476 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | H1C97_RS11625 | Protein ID | WP_000911330.1 |
| Coordinates | 2406077..2406475 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | H1C97_RS11630 | Protein ID | WP_000450524.1 |
| Coordinates | 2406475..2406702 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C97_RS11605 | 2401984..2402184 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| H1C97_RS11610 | 2402265..2402963 | - | 699 | WP_000679812.1 | esterase | - |
| H1C97_RS11615 | 2403037..2405052 | - | 2016 | WP_021565358.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| H1C97_RS11620 | 2405067..2405930 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| H1C97_RS11625 | 2406077..2406475 | - | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| H1C97_RS11630 | 2406475..2406702 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| H1C97_RS11635 | 2406856..2407569 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| H1C97_RS11640 | 2407782..2408816 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| H1C97_RS11645 | 2408833..2409711 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| H1C97_RS11650 | 2409857..2410429 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| H1C97_RS11655 | 2410429..2410899 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T289271 WP_000911330.1 NZ_LR778151:c2406475-2406077 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|