Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1433813..1434339 | Replicon | chromosome |
Accession | NZ_LR778151 | ||
Organism | Escherichia coli isolate SC476 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | H1C97_RS06865 | Protein ID | WP_000323025.1 |
Coordinates | 1433813..1434100 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | H1C97_RS06870 | Protein ID | WP_000534858.1 |
Coordinates | 1434100..1434339 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C97_RS06820 | 1428837..1429052 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
H1C97_RS06825 | 1429806..1430021 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
H1C97_RS06830 | 1430322..1430534 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
H1C97_RS06835 | 1430589..1430678 | + | 90 | WP_120795389.1 | hypothetical protein | - |
H1C97_RS06840 | 1430956..1431708 | - | 753 | WP_001047135.1 | antitermination protein | - |
H1C97_RS06845 | 1431722..1432771 | - | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
H1C97_RS06850 | 1432773..1433051 | - | 279 | WP_012304870.1 | hypothetical protein | - |
H1C97_RS06855 | 1433118..1433369 | - | 252 | WP_000980994.1 | hypothetical protein | - |
H1C97_RS06860 | 1433586..1433741 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
H1C97_RS06865 | 1433813..1434100 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
H1C97_RS06870 | 1434100..1434339 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
H1C97_RS06875 | 1434364..1434669 | + | 306 | WP_001326990.1 | hypothetical protein | - |
H1C97_RS06880 | 1434872..1435204 | + | 333 | WP_001301033.1 | protein FlxA | - |
H1C97_RS06885 | 1435641..1436981 | - | 1341 | WP_000589012.1 | ISNCY family transposase | - |
H1C97_RS06890 | 1437015..1437434 | - | 420 | WP_001151195.1 | DUF977 family protein | - |
H1C97_RS06895 | 1437475..1438440 | - | 966 | WP_000054504.1 | hypothetical protein | - |
H1C97_RS06900 | 1438421..1438942 | - | 522 | WP_000705349.1 | hypothetical protein | - |
H1C97_RS06905 | 1438926..1439153 | - | 228 | WP_000476993.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1398333..1445544 | 47211 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T289265 WP_000323025.1 NZ_LR778151:c1434100-1433813 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|