Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1262161..1262799 | Replicon | chromosome |
Accession | NZ_LR778151 | ||
Organism | Escherichia coli isolate SC476 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | H1C97_RS06045 | Protein ID | WP_000813794.1 |
Coordinates | 1262161..1262337 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | H1C97_RS06050 | Protein ID | WP_001270286.1 |
Coordinates | 1262383..1262799 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C97_RS06025 | 1257780..1258994 | - | 1215 | WP_071830296.1 | BenE family transporter YdcO | - |
H1C97_RS06030 | 1259047..1259583 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
H1C97_RS06035 | 1259656..1261617 | + | 1962 | WP_001442195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
H1C97_RS06040 | 1261709..1261939 | - | 231 | WP_000494244.1 | YncJ family protein | - |
H1C97_RS06045 | 1262161..1262337 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
H1C97_RS06050 | 1262383..1262799 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
H1C97_RS06055 | 1262878..1264287 | + | 1410 | WP_000760591.1 | PLP-dependent aminotransferase family protein | - |
H1C97_RS06060 | 1264529..1265674 | + | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
H1C97_RS06065 | 1265692..1266705 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
H1C97_RS06070 | 1266706..1267647 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1256592..1257740 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T289263 WP_000813794.1 NZ_LR778151:1262161-1262337 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT289263 WP_001270286.1 NZ_LR778151:1262383-1262799 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|