Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 303782..304400 | Replicon | chromosome |
Accession | NZ_LR778151 | ||
Organism | Escherichia coli isolate SC476 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | H1C97_RS01510 | Protein ID | WP_001291435.1 |
Coordinates | 303782..304000 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | H1C97_RS01515 | Protein ID | WP_000344800.1 |
Coordinates | 304026..304400 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C97_RS01475 | 299071..299643 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
H1C97_RS01480 | 299674..299985 | - | 312 | WP_000409911.1 | MGMT family protein | - |
H1C97_RS01490 | 300364..300717 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
H1C97_RS01495 | 300759..302309 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
H1C97_RS01500 | 302473..302943 | - | 471 | WP_000136192.1 | YlaC family protein | - |
H1C97_RS01505 | 303059..303610 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
H1C97_RS01510 | 303782..304000 | - | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
H1C97_RS01515 | 304026..304400 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
H1C97_RS01520 | 304946..308095 | - | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
H1C97_RS01525 | 308118..309311 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T289262 WP_001291435.1 NZ_LR778151:c304000-303782 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT289262 WP_000344800.1 NZ_LR778151:c304400-304026 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |