Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 269483..270320 | Replicon | chromosome |
Accession | NZ_LR778151 | ||
Organism | Escherichia coli isolate SC476 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | H1C97_RS01340 | Protein ID | WP_000227784.1 |
Coordinates | 269483..270025 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | - |
Locus tag | H1C97_RS01345 | Protein ID | WP_112029056.1 |
Coordinates | 270009..270320 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C97_RS01320 | 265021..265932 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
H1C97_RS01325 | 266100..266591 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
H1C97_RS01330 | 266719..268083 | - | 1365 | WP_044687660.1 | MFS transporter | - |
H1C97_RS01335 | 268522..269427 | + | 906 | Protein_258 | sel1 repeat family protein | - |
H1C97_RS01340 | 269483..270025 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
H1C97_RS01345 | 270009..270320 | - | 312 | WP_112029056.1 | DUF1778 domain-containing protein | Antitoxin |
H1C97_RS01350 | 270505..271395 | - | 891 | WP_000971336.1 | heme o synthase | - |
H1C97_RS01355 | 271407..271736 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
H1C97_RS01360 | 271736..272350 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
H1C97_RS01365 | 272340..274331 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
H1C97_RS01370 | 274353..275300 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T289261 WP_000227784.1 NZ_LR778151:c270025-269483 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|