Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 4389098..4389723 | Replicon | chromosome |
| Accession | NZ_LR778149 | ||
| Organism | Escherichia coli isolate SC487 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | H1C96_RS21085 | Protein ID | WP_000911329.1 |
| Coordinates | 4389325..4389723 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | H1C96_RS21080 | Protein ID | WP_000450524.1 |
| Coordinates | 4389098..4389325 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C96_RS21055 | 4384900..4385370 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| H1C96_RS21060 | 4385370..4385942 | - | 573 | WP_097732141.1 | glycine cleavage system transcriptional repressor | - |
| H1C96_RS21065 | 4386088..4386966 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| H1C96_RS21070 | 4386983..4388017 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| H1C96_RS21075 | 4388230..4388943 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| H1C96_RS21080 | 4389098..4389325 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| H1C96_RS21085 | 4389325..4389723 | + | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| H1C96_RS21090 | 4389870..4390733 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| H1C96_RS21095 | 4390748..4392763 | + | 2016 | WP_000829293.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| H1C96_RS21100 | 4392837..4393535 | + | 699 | WP_000679823.1 | esterase | - |
| H1C96_RS21105 | 4393645..4393845 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T289242 WP_000911329.1 NZ_LR778149:4389325-4389723 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |