Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 4103064..4103647 | Replicon | chromosome |
| Accession | NZ_LR778149 | ||
| Organism | Escherichia coli isolate SC487 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | H1C96_RS19700 | Protein ID | WP_000254738.1 |
| Coordinates | 4103312..4103647 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | H1C96_RS19695 | Protein ID | WP_000581937.1 |
| Coordinates | 4103064..4103312 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C96_RS19685 | 4099403..4100704 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| H1C96_RS19690 | 4100752..4102986 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| H1C96_RS19695 | 4103064..4103312 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| H1C96_RS19700 | 4103312..4103647 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| H1C96_RS19705 | 4103718..4104509 | + | 792 | WP_001071643.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| H1C96_RS19710 | 4104737..4106374 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| H1C96_RS19715 | 4106462..4107760 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| H1C96_RS19720 | 4107816..4108178 | - | 363 | WP_000034929.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T289241 WP_000254738.1 NZ_LR778149:4103312-4103647 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|