Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4594790..4595415 | Replicon | chromosome |
Accession | NZ_LR778148 | ||
Organism | Escherichia coli isolate SC475 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | H1C74_RS21960 | Protein ID | WP_000911329.1 |
Coordinates | 4594790..4595188 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | H1C74_RS21965 | Protein ID | WP_000450524.1 |
Coordinates | 4595188..4595415 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C74_RS21940 | 4590668..4590868 | + | 201 | WP_000383836.1 | YpfN family protein | - |
H1C74_RS21945 | 4590978..4591676 | - | 699 | WP_000679823.1 | esterase | - |
H1C74_RS21950 | 4591750..4593765 | - | 2016 | WP_000829293.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
H1C74_RS21955 | 4593780..4594643 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
H1C74_RS21960 | 4594790..4595188 | - | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
H1C74_RS21965 | 4595188..4595415 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
H1C74_RS21970 | 4595570..4596283 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
H1C74_RS21975 | 4596496..4597530 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
H1C74_RS21980 | 4597547..4598425 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
H1C74_RS21985 | 4598571..4599143 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
H1C74_RS21990 | 4599143..4599613 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T289226 WP_000911329.1 NZ_LR778148:c4595188-4594790 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |