Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3646952..3647478 | Replicon | chromosome |
Accession | NZ_LR778148 | ||
Organism | Escherichia coli isolate SC475 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | H1C74_RS17400 | Protein ID | WP_000323025.1 |
Coordinates | 3646952..3647239 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | H1C74_RS17405 | Protein ID | WP_000534858.1 |
Coordinates | 3647239..3647478 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C74_RS17355 | 3641976..3642191 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
H1C74_RS17360 | 3642945..3643160 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
H1C74_RS17365 | 3643461..3643673 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
H1C74_RS17370 | 3643728..3643817 | + | 90 | WP_120795389.1 | hypothetical protein | - |
H1C74_RS17375 | 3644095..3644847 | - | 753 | WP_001047135.1 | antitermination protein | - |
H1C74_RS17380 | 3644861..3645910 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
H1C74_RS17385 | 3645912..3646190 | - | 279 | WP_012304870.1 | hypothetical protein | - |
H1C74_RS17390 | 3646257..3646508 | - | 252 | WP_000980994.1 | hypothetical protein | - |
H1C74_RS17395 | 3646725..3646880 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
H1C74_RS17400 | 3646952..3647239 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
H1C74_RS17405 | 3647239..3647478 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
H1C74_RS17410 | 3647503..3647808 | + | 306 | WP_071527819.1 | hypothetical protein | - |
H1C74_RS17415 | 3648011..3648343 | + | 333 | WP_001317460.1 | FlxA-like family protein | - |
H1C74_RS17420 | 3648780..3650120 | - | 1341 | WP_042054313.1 | ISNCY family transposase | - |
H1C74_RS17425 | 3650154..3650573 | - | 420 | WP_001151196.1 | DUF977 family protein | - |
H1C74_RS17430 | 3650614..3651579 | - | 966 | WP_000054504.1 | hypothetical protein | - |
H1C74_RS17435 | 3651560..3652081 | - | 522 | WP_000705349.1 | hypothetical protein | - |
H1C74_RS17440 | 3652065..3652292 | - | 228 | WP_000476993.1 | transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3604816..3659976 | 55160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T289220 WP_000323025.1 NZ_LR778148:c3647239-3646952 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|