Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 3462276..3462914 | Replicon | chromosome |
| Accession | NZ_LR778148 | ||
| Organism | Escherichia coli isolate SC475 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | H1C74_RS16535 | Protein ID | WP_000813794.1 |
| Coordinates | 3462276..3462452 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | H1C74_RS16540 | Protein ID | WP_001270286.1 |
| Coordinates | 3462498..3462914 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C74_RS16515 | 3457895..3459109 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
| H1C74_RS16520 | 3459162..3459698 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| H1C74_RS16525 | 3459771..3461732 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| H1C74_RS16530 | 3461824..3462054 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| H1C74_RS16535 | 3462276..3462452 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| H1C74_RS16540 | 3462498..3462914 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| H1C74_RS16545 | 3462993..3464399 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| H1C74_RS16550 | 3464644..3465789 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| H1C74_RS16555 | 3465807..3466820 | + | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| H1C74_RS16560 | 3466821..3467762 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3456707..3457855 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T289218 WP_000813794.1 NZ_LR778148:3462276-3462452 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT289218 WP_001270286.1 NZ_LR778148:3462498-3462914 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|