Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 5043047..5043642 | Replicon | chromosome |
| Accession | NZ_LR778147 | ||
| Organism | Escherichia coli isolate SC418 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | H1D11_RS23850 | Protein ID | WP_000239581.1 |
| Coordinates | 5043047..5043397 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | V0YZQ7 |
| Locus tag | H1D11_RS23855 | Protein ID | WP_001223206.1 |
| Coordinates | 5043391..5043642 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D11_RS23830 | 5038501..5039523 | - | 1023 | WP_001361374.1 | ABC transporter permease | - |
| H1D11_RS23835 | 5039537..5041039 | - | 1503 | WP_115423679.1 | sugar ABC transporter ATP-binding protein | - |
| H1D11_RS23840 | 5041172..5042128 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| H1D11_RS23845 | 5042438..5042968 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| H1D11_RS23850 | 5043047..5043397 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| H1D11_RS23855 | 5043391..5043642 | - | 252 | WP_001223206.1 | type II toxin-antitoxin system ChpS family antitoxin | Antitoxin |
| H1D11_RS23860 | 5043854..5044195 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| H1D11_RS23865 | 5044198..5047978 | - | 3781 | Protein_4653 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T289209 WP_000239581.1 NZ_LR778147:c5043397-5043047 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|