Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4782782..4783206 Replicon chromosome
Accession NZ_LR778147
Organism Escherichia coli isolate SC418

Toxin (Protein)


Gene name ccdB Uniprot ID -
Locus tag H1D11_RS22725 Protein ID WP_001306201.1
Coordinates 4782782..4782970 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag H1D11_RS22730 Protein ID WP_000125566.1
Coordinates 4782973..4783206 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D11_RS22695 4778344..4779630 + 1287 WP_000800470.1 peptidylprolyl isomerase SurA -
H1D11_RS22700 4779630..4780619 + 990 WP_000241267.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
H1D11_RS22705 4780616..4781437 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
H1D11_RS22710 4781440..4781817 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
H1D11_RS22715 4781824..4782672 + 849 WP_000257191.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
H1D11_RS22720 4782669..4782785 - 117 WP_000148634.1 CcdB family protein -
H1D11_RS22725 4782782..4782970 - 189 WP_001306201.1 CcdB family protein Toxin
H1D11_RS22730 4782973..4783206 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
H1D11_RS22735 4783292..4783771 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
H1D11_RS22740 4783963..4785825 - 1863 WP_000377113.1 glutathione-regulated potassium-efflux system protein KefC -
H1D11_RS22745 4785818..4786348 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
H1D11_RS22750 4786456..4787787 - 1332 WP_094308470.1 MFS transporter -
H1D11_RS22755 4787846..4788133 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-57)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7167.44 Da        Isoelectric Point: 11.6113

>T289207 WP_001306201.1 NZ_LR778147:c4782970-4782782 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFIRIRPPERLNTILLLVDGS

Download         Length: 189 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT289207 WP_000125566.1 NZ_LR778147:c4783206-4782973 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References