Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4373311..4374148 | Replicon | chromosome |
Accession | NZ_LR778147 | ||
Organism | Escherichia coli isolate SC418 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | H1D11_RS20850 | Protein ID | WP_115423549.1 |
Coordinates | 4373606..4374148 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A0A080JFU1 |
Locus tag | H1D11_RS20845 | Protein ID | WP_001577859.1 |
Coordinates | 4373311..4373622 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D11_RS20820 | 4368331..4369278 | + | 948 | WP_001239436.1 | cytochrome o ubiquinol oxidase subunit II | - |
H1D11_RS20825 | 4369300..4371291 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
H1D11_RS20830 | 4371281..4371895 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
H1D11_RS20835 | 4371895..4372224 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
H1D11_RS20840 | 4372236..4373126 | + | 891 | WP_115423548.1 | heme o synthase | - |
H1D11_RS20845 | 4373311..4373622 | + | 312 | WP_001577859.1 | DUF1778 domain-containing protein | Antitoxin |
H1D11_RS20850 | 4373606..4374148 | + | 543 | WP_115423549.1 | GNAT family N-acetyltransferase | Toxin |
H1D11_RS20855 | 4374204..4375139 | - | 936 | WP_077250576.1 | sel1 repeat family protein | - |
H1D11_RS20860 | 4375546..4376910 | + | 1365 | WP_001000953.1 | MFS transporter | - |
H1D11_RS20865 | 4377038..4377529 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
H1D11_RS20870 | 4377697..4378608 | + | 912 | WP_115423551.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19822.99 Da Isoelectric Point: 8.3395
>T289205 WP_115423549.1 NZ_LR778147:4373606-4374148 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRTSLKKSVRNSDCAAKALIDRQSGELIGTCTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRTSLKKSVRNSDCAAKALIDRQSGELIGTCTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|