Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3936526..3937231 | Replicon | chromosome |
| Accession | NZ_LR778147 | ||
| Organism | Escherichia coli isolate SC418 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | H1D11_RS18900 | Protein ID | WP_000539521.1 |
| Coordinates | 3936526..3936912 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | H1D11_RS18905 | Protein ID | WP_001280945.1 |
| Coordinates | 3936902..3937231 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D11_RS18880 | 3932530..3933156 | + | 627 | WP_001314584.1 | glutathione S-transferase GstB | - |
| H1D11_RS18885 | 3933153..3934268 | - | 1116 | WP_000555033.1 | aldose sugar dehydrogenase YliI | - |
| H1D11_RS18890 | 3934379..3934762 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| H1D11_RS18895 | 3934975..3936300 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| H1D11_RS18900 | 3936526..3936912 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| H1D11_RS18905 | 3936902..3937231 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| H1D11_RS18910 | 3937301..3938629 | - | 1329 | WP_000086873.1 | GGDEF domain-containing protein | - |
| H1D11_RS18915 | 3938637..3940985 | - | 2349 | WP_001305945.1 | EAL domain-containing protein | - |
| H1D11_RS18920 | 3941163..3942074 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T289203 WP_000539521.1 NZ_LR778147:3936526-3936912 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|