Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 3239289..3239927 | Replicon | chromosome |
| Accession | NZ_LR778147 | ||
| Organism | Escherichia coli isolate SC418 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B7N4J4 |
| Locus tag | H1D11_RS15395 | Protein ID | WP_000813797.1 |
| Coordinates | 3239751..3239927 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | H1D11_RS15390 | Protein ID | WP_076611057.1 |
| Coordinates | 3239289..3239705 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D11_RS15370 | 3234441..3235382 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| H1D11_RS15375 | 3235383..3236396 | - | 1014 | WP_000220413.1 | ABC transporter ATP-binding protein | - |
| H1D11_RS15380 | 3236414..3237559 | - | 1146 | WP_115423856.1 | ABC transporter substrate-binding protein | - |
| H1D11_RS15385 | 3237804..3239210 | - | 1407 | WP_115423855.1 | PLP-dependent aminotransferase family protein | - |
| H1D11_RS15390 | 3239289..3239705 | - | 417 | WP_076611057.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| H1D11_RS15395 | 3239751..3239927 | - | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| H1D11_RS15400 | 3240149..3240379 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| H1D11_RS15405 | 3240471..3242432 | - | 1962 | WP_115423854.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| H1D11_RS15410 | 3242505..3243041 | - | 537 | WP_000429506.1 | DNA-binding transcriptional regulator SutR | - |
| H1D11_RS15415 | 3243094..3244305 | + | 1212 | WP_096132700.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T289202 WP_000813797.1 NZ_LR778147:c3239927-3239751 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15251.65 Da Isoelectric Point: 4.5908
>AT289202 WP_076611057.1 NZ_LR778147:c3239705-3239289 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|