Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1339701..1340536 Replicon chromosome
Accession NZ_LR778147
Organism Escherichia coli isolate SC418

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag H1D11_RS06185 Protein ID WP_115431496.1
Coordinates 1339701..1340078 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7H9LMS7
Locus tag H1D11_RS06190 Protein ID WP_033546297.1
Coordinates 1340168..1340536 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D11_RS06170 1334905..1335006 - 102 Protein_1194 DUF4942 domain-containing protein -
H1D11_RS06175 1335314..1338364 - 3051 WP_089581459.1 autotransporter outer membrane beta-barrel domain-containing protein -
H1D11_RS24740 1339282..1339479 - 198 WP_089581460.1 DUF957 domain-containing protein -
H1D11_RS24745 1339555..1339704 - 150 Protein_1197 hypothetical protein -
H1D11_RS06185 1339701..1340078 - 378 WP_115431496.1 TA system toxin CbtA family protein Toxin
H1D11_RS06190 1340168..1340536 - 369 WP_033546297.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
H1D11_RS06195 1340615..1340836 - 222 WP_115423582.1 DUF987 domain-containing protein -
H1D11_RS06200 1340899..1341375 - 477 WP_180349146.1 RadC family protein -
H1D11_RS06205 1341391..1341876 - 486 WP_000214393.1 antirestriction protein -
H1D11_RS06210 1341967..1342785 - 819 WP_115431481.1 DUF945 domain-containing protein -
H1D11_RS06215 1342883..1343194 - 312 WP_001608658.1 hypothetical protein -
H1D11_RS06220 1343533..1343811 - 279 WP_001545361.1 hypothetical protein -
H1D11_RS06225 1344073..1344753 - 681 WP_089581517.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / pefD / draA / faeC / faeD / faeE / faeF / faeH / faeI / faeJ / vipA/tssB / vipB/tssC / hcp/tssD / clpV/tssH 1230983..1445664 214681


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14229.37 Da        Isoelectric Point: 8.5128

>T289193 WP_115431496.1 NZ_LR778147:c1340078-1339701 [Escherichia coli]
MKTLPDTHIREASRCPCPVTIWQTLLTRLLDRHYGLTLNDTPFADERVIEQHIEAGISLCDAVNVLVEKYALVRTDQSGF
SICPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13579.31 Da        Isoelectric Point: 6.0586

>AT289193 WP_033546297.1 NZ_LR778147:c1340536-1340168 [Escherichia coli]
VSDTLPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKT

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A7H9LMS7

References