Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2280..3115 | Replicon | chromosome |
| Accession | NZ_LR778147 | ||
| Organism | Escherichia coli isolate SC418 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | H1D11_RS00030 | Protein ID | WP_000854684.1 |
| Coordinates | 2738..3115 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | H1D11_RS00025 | Protein ID | WP_180349223.1 |
| Coordinates | 2280..2648 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D11_RS00005 | 24..842 | + | 819 | WP_001234700.1 | DUF945 domain-containing protein | - |
| H1D11_RS00010 | 934..1419 | + | 486 | WP_000206667.1 | antirestriction protein | - |
| H1D11_RS00015 | 1435..1911 | + | 477 | WP_001186711.1 | RadC family protein | - |
| H1D11_RS00020 | 1980..2201 | + | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| H1D11_RS00025 | 2280..2648 | + | 369 | WP_180349223.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| H1D11_RS00030 | 2738..3115 | + | 378 | WP_000854684.1 | TA system toxin CbtA family protein | Toxin |
| H1D11_RS24720 | 3112..3291 | + | 180 | Protein_6 | hypothetical protein | - |
| H1D11_RS24725 | 3340..3534 | + | 195 | WP_032216488.1 | DUF957 domain-containing protein | - |
| H1D11_RS00040 | 4453..6564 | + | 2112 | Protein_8 | autotransporter outer membrane beta-barrel domain-containing protein | - |
| H1D11_RS00045 | 6710..7729 | + | 1020 | WP_000878012.1 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14278.29 Da Isoelectric Point: 8.2761
>T289188 WP_000854684.1 NZ_LR778147:2738-3115 [Escherichia coli]
MKTLPDTHIREASRCPSPVTVWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
MKTLPDTHIREASRCPSPVTVWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYQEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|