Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 4485161..4485744 | Replicon | chromosome |
Accession | NZ_LR778146 | ||
Organism | Escherichia coli isolate SC455 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | H1D08_RS21685 | Protein ID | WP_000254750.1 |
Coordinates | 4485409..4485744 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | H1D08_RS21680 | Protein ID | WP_000581937.1 |
Coordinates | 4485161..4485409 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D08_RS21670 | 4481500..4482801 | + | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
H1D08_RS21675 | 4482849..4485083 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
H1D08_RS21680 | 4485161..4485409 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
H1D08_RS21685 | 4485409..4485744 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
H1D08_RS21690 | 4485816..4486607 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
H1D08_RS21695 | 4486835..4488472 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
H1D08_RS21700 | 4488560..4489858 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T289186 WP_000254750.1 NZ_LR778146:4485409-4485744 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|