Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4365146..4365800 | Replicon | chromosome |
Accession | NZ_LR778146 | ||
Organism | Escherichia coli isolate SC455 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | H1D08_RS21190 | Protein ID | WP_000244781.1 |
Coordinates | 4365393..4365800 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | H1D08_RS21185 | Protein ID | WP_000354046.1 |
Coordinates | 4365146..4365412 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D08_RS21165 | 4361234..4362667 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
H1D08_RS21170 | 4362712..4363023 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
H1D08_RS21175 | 4363187..4363846 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
H1D08_RS21180 | 4363923..4364903 | - | 981 | WP_137429057.1 | tRNA-modifying protein YgfZ | - |
H1D08_RS21185 | 4365146..4365412 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
H1D08_RS21190 | 4365393..4365800 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
H1D08_RS21195 | 4365840..4366361 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
H1D08_RS21200 | 4366473..4367369 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
H1D08_RS21205 | 4367394..4368104 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
H1D08_RS21210 | 4368110..4369843 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T289185 WP_000244781.1 NZ_LR778146:4365393-4365800 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|