Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3797238..3797833 Replicon chromosome
Accession NZ_LR778146
Organism Escherichia coli isolate SC455

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag H1D08_RS18350 Protein ID WP_175058671.1
Coordinates 3797456..3797833 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag H1D08_RS18345 Protein ID WP_000557315.1
Coordinates 3797238..3797459 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D08_RS18320 3792314..3793423 + 1110 WP_001316697.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
H1D08_RS18325 3793471..3794397 + 927 WP_001295097.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
H1D08_RS18330 3794394..3795671 + 1278 WP_000803817.1 branched chain amino acid ABC transporter permease LivM -
H1D08_RS18335 3795668..3796435 + 768 WP_033811128.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
H1D08_RS18340 3796437..3797150 + 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
H1D08_RS18345 3797238..3797459 + 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
H1D08_RS18350 3797456..3797833 + 378 WP_175058671.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
H1D08_RS18355 3798042..3799358 + 1317 WP_021531661.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
H1D08_RS18360 3799456..3800343 + 888 WP_000099282.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
H1D08_RS18365 3800340..3801185 + 846 WP_000572183.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
H1D08_RS18370 3801187..3802257 + 1071 WP_000907824.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3794394..3802997 8603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13975.23 Da        Isoelectric Point: 6.4830

>T289183 WP_175058671.1 NZ_LR778146:3797456-3797833 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNSLILAANPEFVELTVDVAAGKVSLEDIVTRLRQHGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT289183 WP_000557315.1 NZ_LR778146:3797238-3797459 [Escherichia coli]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References