Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 3230870..3231486 Replicon chromosome
Accession NZ_LR778146
Organism Escherichia coli isolate SC455

Toxin (Protein)


Gene name vapC Uniprot ID A0A176ZIX8
Locus tag H1D08_RS15640 Protein ID WP_001129490.1
Coordinates 3230870..3231244 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag H1D08_RS15645 Protein ID WP_001591266.1
Coordinates 3231244..3231486 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D08_RS15625 3228373..3229275 + 903 WP_000331377.1 formate dehydrogenase O subunit beta -
H1D08_RS15630 3229272..3229907 + 636 WP_000829013.1 formate dehydrogenase cytochrome b556 subunit -
H1D08_RS15635 3229904..3230833 + 930 WP_000027720.1 formate dehydrogenase accessory protein FdhE -
H1D08_RS15640 3230870..3231244 - 375 WP_001129490.1 type II toxin-antitoxin system VapC family toxin Toxin
H1D08_RS15645 3231244..3231486 - 243 WP_001591266.1 ribbon-helix-helix domain-containing protein Antitoxin
H1D08_RS15650 3231706..3231924 - 219 WP_001468130.1 ribbon-helix-helix domain-containing protein -
H1D08_RS15655 3232323..3232685 + 363 WP_175058636.1 type II toxin-antitoxin system HigB family toxin -
H1D08_RS15660 3232630..3233085 + 456 WP_001534936.1 helix-turn-helix domain-containing protein -
H1D08_RS15665 3233096..3234037 - 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
H1D08_RS15670 3234082..3234519 - 438 WP_000560990.1 D-tyrosyl-tRNA(Tyr) deacylase -
H1D08_RS15675 3234516..3235388 - 873 WP_000920762.1 virulence factor BrkB family protein -
H1D08_RS15680 3235382..3235981 - 600 WP_001298594.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(15-48)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13960.19 Da        Isoelectric Point: 7.0126

>T289179 WP_001129490.1 NZ_LR778146:c3231244-3230870 [Escherichia coli]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9318.60 Da        Isoelectric Point: 4.3774

>AT289179 WP_001591266.1 NZ_LR778146:c3231486-3231244 [Escherichia coli]
MSVMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVDQYLENQSKTTISSAFGIWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A176ZIX8

Antitoxin

Source ID Structure

References