Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2606017..2606567 Replicon chromosome
Accession NZ_LR778146
Organism Escherichia coli isolate SC455

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag H1D08_RS12775 Protein ID WP_001160966.1
Coordinates 2606017..2606331 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag H1D08_RS12780 Protein ID WP_000125566.1
Coordinates 2606334..2606567 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D08_RS12750 2601692..2602978 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
H1D08_RS12755 2602978..2603967 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
H1D08_RS12760 2603964..2604785 + 822 WP_001065366.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
H1D08_RS12765 2604788..2605165 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
H1D08_RS12770 2605172..2606020 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
H1D08_RS12775 2606017..2606331 - 315 WP_001160966.1 CcdB family protein Toxin
H1D08_RS12780 2606334..2606567 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
H1D08_RS12785 2606653..2607132 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
H1D08_RS12790 2607324..2609186 - 1863 WP_000377117.1 glutathione-regulated potassium-efflux system protein KefC -
H1D08_RS12795 2609179..2609709 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
H1D08_RS12800 2609817..2611148 - 1332 WP_175058590.1 MFS transporter -
H1D08_RS12805 2611207..2611494 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T289177 WP_001160966.1 NZ_LR778146:c2606331-2606017 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT289177 WP_000125566.1 NZ_LR778146:c2606567-2606334 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References