Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1461328..1462112 | Replicon | chromosome |
Accession | NZ_LR778146 | ||
Organism | Escherichia coli isolate SC455 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | H1D08_RS07025 | Protein ID | WP_000613626.1 |
Coordinates | 1461618..1462112 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B1LI61 |
Locus tag | H1D08_RS07020 | Protein ID | WP_001110446.1 |
Coordinates | 1461328..1461621 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D08_RS07010 | 1456477..1457436 | - | 960 | WP_000846343.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
H1D08_RS07015 | 1458009..1461194 | + | 3186 | WP_097447887.1 | ribonuclease E | - |
H1D08_RS07020 | 1461328..1461621 | + | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
H1D08_RS07025 | 1461618..1462112 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
H1D08_RS07030 | 1462207..1463160 | - | 954 | WP_001212764.1 | flagellar hook-associated protein FlgL | - |
H1D08_RS07035 | 1463172..1464815 | - | 1644 | WP_053898721.1 | flagellar hook-associated protein FlgK | - |
H1D08_RS07040 | 1464881..1465822 | - | 942 | WP_001337731.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
H1D08_RS07045 | 1465822..1466920 | - | 1099 | Protein_1382 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T289174 WP_000613626.1 NZ_LR778146:1461618-1462112 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0T0H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G775 |