Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4478252..4478847 | Replicon | chromosome |
Accession | NZ_LR778145 | ||
Organism | Escherichia coli isolate SC423 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9Y4M4 |
Locus tag | H1C75_RS21335 | Protein ID | WP_000239579.1 |
Coordinates | 4478252..4478602 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | H1C75_RS21340 | Protein ID | WP_001223208.1 |
Coordinates | 4478596..4478847 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C75_RS21315 | 4473698..4474720 | - | 1023 | WP_001356014.1 | ABC transporter permease | - |
H1C75_RS21320 | 4474734..4476236 | - | 1503 | WP_049032561.1 | sugar ABC transporter ATP-binding protein | - |
H1C75_RS21325 | 4476376..4477332 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
H1C75_RS21330 | 4477642..4478172 | + | 531 | WP_000055070.1 | inorganic diphosphatase | - |
H1C75_RS21335 | 4478252..4478602 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
H1C75_RS21340 | 4478596..4478847 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
H1C75_RS21345 | 4479059..4479400 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
H1C75_RS21350 | 4479403..4483182 | - | 3780 | WP_053264521.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T289166 WP_000239579.1 NZ_LR778145:c4478602-4478252 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |