Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3789520..3790138 | Replicon | chromosome |
Accession | NZ_LR778145 | ||
Organism | Escherichia coli isolate SC423 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | H1C75_RS18115 | Protein ID | WP_001291435.1 |
Coordinates | 3789920..3790138 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | H1C75_RS18110 | Protein ID | WP_000344800.1 |
Coordinates | 3789520..3789894 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C75_RS18100 | 3784609..3785802 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
H1C75_RS18105 | 3785825..3788974 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
H1C75_RS18110 | 3789520..3789894 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
H1C75_RS18115 | 3789920..3790138 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
H1C75_RS18120 | 3790309..3790860 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
H1C75_RS18125 | 3790976..3791446 | + | 471 | WP_000136192.1 | YlaC family protein | - |
H1C75_RS18130 | 3791610..3793160 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
H1C75_RS18135 | 3793202..3793555 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T289163 WP_001291435.1 NZ_LR778145:3789920-3790138 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT289163 WP_000344800.1 NZ_LR778145:3789520-3789894 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |