Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1672801..1673426 | Replicon | chromosome |
| Accession | NZ_LR778145 | ||
| Organism | Escherichia coli isolate SC423 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | H1C75_RS07945 | Protein ID | WP_000911329.1 |
| Coordinates | 1673028..1673426 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | H1C75_RS07940 | Protein ID | WP_000450524.1 |
| Coordinates | 1672801..1673028 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C75_RS07915 | 1668603..1669073 | - | 471 | WP_089620216.1 | thioredoxin-dependent thiol peroxidase | - |
| H1C75_RS07920 | 1669073..1669645 | - | 573 | WP_000176191.1 | glycine cleavage system transcriptional repressor | - |
| H1C75_RS07925 | 1669791..1670669 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| H1C75_RS07930 | 1670686..1671720 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| H1C75_RS07935 | 1671933..1672646 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| H1C75_RS07940 | 1672801..1673028 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| H1C75_RS07945 | 1673028..1673426 | + | 399 | WP_000911329.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| H1C75_RS07950 | 1673573..1674436 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| H1C75_RS07955 | 1674451..1676466 | + | 2016 | WP_047084717.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| H1C75_RS07960 | 1676540..1677238 | + | 699 | WP_000679823.1 | esterase | - |
| H1C75_RS07965 | 1677348..1677548 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T289157 WP_000911329.1 NZ_LR778145:1673028-1673426 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |