Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1204111..1204765 | Replicon | chromosome |
| Accession | NZ_LR778145 | ||
| Organism | Escherichia coli isolate SC423 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | H1C75_RS05755 | Protein ID | WP_000244781.1 |
| Coordinates | 1204358..1204765 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | H1C75_RS05750 | Protein ID | WP_000354046.1 |
| Coordinates | 1204111..1204377 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C75_RS05725 | 1199280..1200023 | + | 744 | WP_000951961.1 | SDR family oxidoreductase | - |
| H1C75_RS05730 | 1200080..1201513 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
| H1C75_RS05735 | 1201558..1201869 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| H1C75_RS05740 | 1202033..1202692 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| H1C75_RS05745 | 1202888..1203868 | - | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
| H1C75_RS05750 | 1204111..1204377 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| H1C75_RS05755 | 1204358..1204765 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| H1C75_RS05760 | 1204805..1205326 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| H1C75_RS05765 | 1205438..1206334 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| H1C75_RS05770 | 1206359..1207069 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| H1C75_RS05775 | 1207075..1208808 | + | 1734 | WP_000813223.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T289155 WP_000244781.1 NZ_LR778145:1204358-1204765 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|