Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2969125..2969750 | Replicon | chromosome |
| Accession | NZ_LR778143 | ||
| Organism | Escherichia coli isolate SC422 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | H1C98_RS14255 | Protein ID | WP_000911330.1 |
| Coordinates | 2969352..2969750 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | H1C98_RS14250 | Protein ID | WP_000450524.1 |
| Coordinates | 2969125..2969352 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C98_RS14225 | 2964928..2965398 | - | 471 | WP_001068677.1 | thioredoxin-dependent thiol peroxidase | - |
| H1C98_RS14230 | 2965398..2965970 | - | 573 | WP_000176191.1 | glycine cleavage system transcriptional repressor | - |
| H1C98_RS14235 | 2966116..2966994 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| H1C98_RS14240 | 2967011..2968045 | + | 1035 | WP_001358397.1 | outer membrane protein assembly factor BamC | - |
| H1C98_RS14245 | 2968258..2968971 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| H1C98_RS14250 | 2969125..2969352 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| H1C98_RS14255 | 2969352..2969750 | + | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| H1C98_RS14260 | 2969897..2970760 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| H1C98_RS14265 | 2970775..2972790 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| H1C98_RS14270 | 2972864..2973562 | + | 699 | WP_000679823.1 | esterase | - |
| H1C98_RS14275 | 2973672..2973872 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T289144 WP_000911330.1 NZ_LR778143:2969352-2969750 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|