Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1556771..1557606 | Replicon | chromosome |
Accession | NZ_LR778143 | ||
Organism | Escherichia coli isolate SC422 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | H1C98_RS07400 | Protein ID | WP_085447097.1 |
Coordinates | 1556771..1557148 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | H1C98_RS07405 | Protein ID | WP_115425271.1 |
Coordinates | 1557238..1557606 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C98_RS07380 | 1551982..1552083 | - | 102 | Protein_1431 | DUF4942 domain-containing protein | - |
H1C98_RS07385 | 1552391..1555435 | - | 3045 | WP_089592676.1 | autotransporter outer membrane beta-barrel domain-containing protein | - |
H1C98_RS07390 | 1556352..1556549 | - | 198 | WP_089581460.1 | DUF957 domain-containing protein | - |
H1C98_RS07395 | 1556577..1556774 | - | 198 | Protein_1434 | hypothetical protein | - |
H1C98_RS07400 | 1556771..1557148 | - | 378 | WP_085447097.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
H1C98_RS07405 | 1557238..1557606 | - | 369 | WP_115425271.1 | type IV toxin-antitoxin system toxin CbtA | Antitoxin |
H1C98_RS07410 | 1557680..1557901 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
H1C98_RS07415 | 1557964..1558440 | - | 477 | WP_001186773.1 | RadC family protein | - |
H1C98_RS07420 | 1558456..1558941 | - | 486 | WP_174490312.1 | antirestriction protein | - |
H1C98_RS07425 | 1559033..1559851 | - | 819 | WP_115425206.1 | DUF945 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeC / faeD / faeE / faeF / faeH / faeI / faeJ | 1552391..1594832 | 42441 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14101.24 Da Isoelectric Point: 8.5162
>T289138 WP_085447097.1 NZ_LR778143:c1557148-1556771 [Escherichia coli]
MKTLPVLPGQAVSSRLSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEVKR
MKTLPVLPGQAVSSRLSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEVKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13562.36 Da Isoelectric Point: 5.5269
>AT289138 WP_115425271.1 NZ_LR778143:c1557606-1557238 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|