Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1007508..1008343 | Replicon | chromosome |
Accession | NZ_LR778143 | ||
Organism | Escherichia coli isolate SC422 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | H1C98_RS04905 | Protein ID | WP_061356574.1 |
Coordinates | 1007966..1008343 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | H1C98_RS04900 | Protein ID | WP_061356575.1 |
Coordinates | 1007508..1007876 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C98_RS04860 | 1002787..1003467 | + | 681 | WP_001282912.1 | WYL domain-containing protein | - |
H1C98_RS04865 | 1003618..1004295 | + | 678 | WP_001097567.1 | hypothetical protein | - |
H1C98_RS04870 | 1004301..1004534 | + | 234 | WP_001278282.1 | DUF905 family protein | - |
H1C98_RS04875 | 1004624..1005442 | + | 819 | WP_115425218.1 | DUF945 domain-containing protein | - |
H1C98_RS04880 | 1005534..1006019 | + | 486 | WP_000213706.1 | antirestriction protein | - |
H1C98_RS04885 | 1006034..1006510 | + | 477 | WP_143370560.1 | RadC family protein | - |
H1C98_RS04890 | 1006573..1006794 | + | 222 | WP_061356703.1 | DUF987 domain-containing protein | - |
H1C98_RS04895 | 1006813..1007458 | + | 646 | Protein_961 | antitoxin of toxin-antitoxin stability system | - |
H1C98_RS04900 | 1007508..1007876 | + | 369 | WP_061356575.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
H1C98_RS04905 | 1007966..1008343 | + | 378 | WP_061356574.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
H1C98_RS04910 | 1008340..1008828 | + | 489 | WP_097743434.1 | hypothetical protein | - |
H1C98_RS04915 | 1008848..1009045 | + | 198 | WP_097743433.1 | DUF957 domain-containing protein | - |
H1C98_RS04920 | 1009130..1009975 | + | 846 | WP_097743432.1 | DUF4942 domain-containing protein | - |
H1C98_RS04925 | 1010046..1011582 | + | 1537 | Protein_967 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13988.94 Da Isoelectric Point: 7.8847
>T289135 WP_061356574.1 NZ_LR778143:1007966-1008343 [Escherichia coli]
MNTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITSGKHPEAKR
MNTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITSGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13602.30 Da Isoelectric Point: 5.9582
>AT289135 WP_061356575.1 NZ_LR778143:1007508-1007876 [Escherichia coli]
VSDTLSGTTHPDDNNERPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNNERPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|