Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4553891..4554507 Replicon chromosome
Accession NZ_LR778142
Organism Escherichia coli isolate SC434

Toxin (Protein)


Gene name vapC Uniprot ID A0A176ZIX8
Locus tag H1D10_RS22155 Protein ID WP_001129490.1
Coordinates 4554133..4554507 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag H1D10_RS22150 Protein ID WP_001591266.1
Coordinates 4553891..4554133 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D10_RS22115 4549396..4549995 + 600 WP_001298594.1 glucose-1-phosphatase -
H1D10_RS22120 4549989..4550861 + 873 WP_000920762.1 virulence factor BrkB family protein -
H1D10_RS22125 4550858..4551295 + 438 WP_000560990.1 D-tyrosyl-tRNA(Tyr) deacylase -
H1D10_RS22130 4551340..4552281 + 942 WP_001297068.1 fatty acid biosynthesis protein FabY -
H1D10_RS22135 4552292..4552747 - 456 WP_001534936.1 helix-turn-helix domain-containing protein -
H1D10_RS22140 4552692..4553054 - 363 WP_175058636.1 type II toxin-antitoxin system HigB family toxin -
H1D10_RS22145 4553453..4553671 + 219 WP_001468130.1 ribbon-helix-helix domain-containing protein -
H1D10_RS22150 4553891..4554133 + 243 WP_001591266.1 ribbon-helix-helix domain-containing protein Antitoxin
H1D10_RS22155 4554133..4554507 + 375 WP_001129490.1 type II toxin-antitoxin system VapC family toxin Toxin
H1D10_RS22160 4554544..4555473 - 930 WP_000027720.1 formate dehydrogenase accessory protein FdhE -
H1D10_RS22165 4555470..4556105 - 636 WP_000829013.1 formate dehydrogenase cytochrome b556 subunit -
H1D10_RS22170 4556102..4557004 - 903 WP_000331377.1 formate dehydrogenase O subunit beta -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(15-48)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13960.19 Da        Isoelectric Point: 7.0126

>T289130 WP_001129490.1 NZ_LR778142:4554133-4554507 [Escherichia coli]
MAKRTALFDTNILIDLFSGRIEAKQALEAWPLQNAISLVTWMEVLVGAKKYDQEHRTRIAMSAFNVIGISQDIAERSVAL
RQEYRMKLPDAIILATAQIYGFELVTRNTRDFAGIAGVVTPYEL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9318.60 Da        Isoelectric Point: 4.3774

>AT289130 WP_001591266.1 NZ_LR778142:4553891-4554133 [Escherichia coli]
MSVMAGMDMGRILLDLSDEVIKRLDDLKVQRNLPRAELLREAVDQYLENQSKTTISSAFGIWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A176ZIX8

Antitoxin

Source ID Structure

References