Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3987544..3988139 Replicon chromosome
Accession NZ_LR778142
Organism Escherichia coli isolate SC434

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag H1D10_RS19445 Protein ID WP_175058671.1
Coordinates 3987544..3987921 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID D6JG32
Locus tag H1D10_RS19450 Protein ID WP_000557315.1
Coordinates 3987918..3988139 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D10_RS19425 3983120..3984190 - 1071 WP_000907824.1 sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC -
H1D10_RS19430 3984192..3985037 - 846 WP_000572183.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
H1D10_RS19435 3985034..3985921 - 888 WP_000099282.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
H1D10_RS19440 3986019..3987335 - 1317 WP_021531661.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
H1D10_RS19445 3987544..3987921 - 378 WP_175058671.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
H1D10_RS19450 3987918..3988139 - 222 WP_000557315.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
H1D10_RS19455 3988227..3988940 - 714 WP_000416895.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
H1D10_RS19460 3988942..3989709 - 768 WP_033811128.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
H1D10_RS19465 3989706..3990983 - 1278 WP_000803817.1 branched chain amino acid ABC transporter permease LivM -
H1D10_RS19470 3990980..3991906 - 927 WP_001295097.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
H1D10_RS19475 3991954..3993063 - 1110 WP_001316697.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3982380..3990983 8603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-53)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13975.23 Da        Isoelectric Point: 6.4830

>T289126 WP_175058671.1 NZ_LR778142:c3987921-3987544 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNSLILAANPEFVELTVDVAAGKVSLEDIVTRLRQHGT

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8103.24 Da        Isoelectric Point: 6.2168

>AT289126 WP_000557315.1 NZ_LR778142:c3988139-3987918 [Escherichia coli]
MHTMNYSEARQNLALVLETAATGTPVTITRRGHKAAVIISAEEFERYQKAKLDAEFDAIMAIHGSEIKELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB D6JG32

References