Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 3987544..3988139 | Replicon | chromosome |
| Accession | NZ_LR778142 | ||
| Organism | Escherichia coli isolate SC434 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | H1D10_RS19445 | Protein ID | WP_175058671.1 |
| Coordinates | 3987544..3987921 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | D6JG32 |
| Locus tag | H1D10_RS19450 | Protein ID | WP_000557315.1 |
| Coordinates | 3987918..3988139 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1D10_RS19425 | 3983120..3984190 | - | 1071 | WP_000907824.1 | sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC | - |
| H1D10_RS19430 | 3984192..3985037 | - | 846 | WP_000572183.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| H1D10_RS19435 | 3985034..3985921 | - | 888 | WP_000099282.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| H1D10_RS19440 | 3986019..3987335 | - | 1317 | WP_021531661.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| H1D10_RS19445 | 3987544..3987921 | - | 378 | WP_175058671.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| H1D10_RS19450 | 3987918..3988139 | - | 222 | WP_000557315.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| H1D10_RS19455 | 3988227..3988940 | - | 714 | WP_000416895.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| H1D10_RS19460 | 3988942..3989709 | - | 768 | WP_033811128.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| H1D10_RS19465 | 3989706..3990983 | - | 1278 | WP_000803817.1 | branched chain amino acid ABC transporter permease LivM | - |
| H1D10_RS19470 | 3990980..3991906 | - | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| H1D10_RS19475 | 3991954..3993063 | - | 1110 | WP_001316697.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3982380..3990983 | 8603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13975.23 Da Isoelectric Point: 6.4830
>T289126 WP_175058671.1 NZ_LR778142:c3987921-3987544 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNSLILAANPEFVELTVDVAAGKVSLEDIVTRLRQHGT
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNSLILAANPEFVELTVDVAAGKVSLEDIVTRLRQHGT
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|