Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3419644..3420298 | Replicon | chromosome |
Accession | NZ_LR778142 | ||
Organism | Escherichia coli isolate SC434 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | H1D10_RS16605 | Protein ID | WP_000244781.1 |
Coordinates | 3419644..3420051 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | H1D10_RS16610 | Protein ID | WP_000354046.1 |
Coordinates | 3420032..3420298 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D10_RS16585 | 3415600..3417333 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
H1D10_RS16590 | 3417343..3418050 | - | 708 | WP_180349102.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
H1D10_RS16595 | 3418075..3418971 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
H1D10_RS16600 | 3419083..3419604 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
H1D10_RS16605 | 3419644..3420051 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
H1D10_RS16610 | 3420032..3420298 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
H1D10_RS16615 | 3420541..3421521 | + | 981 | WP_137429057.1 | tRNA-modifying protein YgfZ | - |
H1D10_RS16620 | 3421598..3422257 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
H1D10_RS16625 | 3422421..3422732 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
H1D10_RS16630 | 3422777..3424210 | + | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T289124 WP_000244781.1 NZ_LR778142:c3420051-3419644 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|