Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3299699..3300282 | Replicon | chromosome |
Accession | NZ_LR778142 | ||
Organism | Escherichia coli isolate SC434 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | H1D10_RS16110 | Protein ID | WP_000254750.1 |
Coordinates | 3299699..3300034 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | H1D10_RS16115 | Protein ID | WP_000581937.1 |
Coordinates | 3300034..3300282 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D10_RS16095 | 3295585..3296883 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
H1D10_RS16100 | 3296971..3298608 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
H1D10_RS16105 | 3298836..3299627 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
H1D10_RS16110 | 3299699..3300034 | - | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
H1D10_RS16115 | 3300034..3300282 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
H1D10_RS16120 | 3300360..3302594 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
H1D10_RS16125 | 3302642..3303943 | - | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T289123 WP_000254750.1 NZ_LR778142:c3300034-3299699 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|