Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1668145..1668929 | Replicon | chromosome |
Accession | NZ_LR778142 | ||
Organism | Escherichia coli isolate SC434 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | H1D10_RS08205 | Protein ID | WP_000613626.1 |
Coordinates | 1668145..1668639 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B1LI61 |
Locus tag | H1D10_RS08210 | Protein ID | WP_001110446.1 |
Coordinates | 1668636..1668929 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1D10_RS08185 | 1663338..1664435 | + | 1098 | WP_000589300.1 | flagellar basal body P-ring protein FlgI | - |
H1D10_RS08190 | 1664435..1665376 | + | 942 | WP_001337731.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
H1D10_RS08195 | 1665442..1667085 | + | 1644 | WP_053898721.1 | flagellar hook-associated protein FlgK | - |
H1D10_RS08200 | 1667097..1668050 | + | 954 | WP_001212764.1 | flagellar hook-associated protein FlgL | - |
H1D10_RS08205 | 1668145..1668639 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
H1D10_RS08210 | 1668636..1668929 | - | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
H1D10_RS08215 | 1669063..1672248 | - | 3186 | WP_097447887.1 | ribonuclease E | - |
H1D10_RS08220 | 1672821..1673780 | + | 960 | WP_000846343.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T289115 WP_000613626.1 NZ_LR778142:c1668639-1668145 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0T0H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G775 |