Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 520587..521137 Replicon chromosome
Accession NZ_LR778142
Organism Escherichia coli isolate SC434

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag H1D10_RS02440 Protein ID WP_001160966.1
Coordinates 520823..521137 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag H1D10_RS02435 Protein ID WP_000125566.1
Coordinates 520587..520820 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1D10_RS02410 515660..515947 + 288 WP_000203741.1 ferredoxin-like protein FixX -
H1D10_RS02415 516006..517337 + 1332 WP_175058590.1 MFS transporter -
H1D10_RS02420 517445..517975 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
H1D10_RS02425 517968..519830 + 1863 WP_000377117.1 glutathione-regulated potassium-efflux system protein KefC -
H1D10_RS02430 520022..520501 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
H1D10_RS02435 520587..520820 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
H1D10_RS02440 520823..521137 + 315 WP_001160966.1 CcdB family protein Toxin
H1D10_RS02445 521134..521982 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
H1D10_RS02450 521989..522366 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
H1D10_RS02455 522369..523190 - 822 WP_001065366.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
H1D10_RS02460 523187..524176 - 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
H1D10_RS02465 524176..525462 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T289112 WP_001160966.1 NZ_LR778142:520823-521137 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT289112 WP_000125566.1 NZ_LR778142:520587-520820 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References