Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2869779..2870577 | Replicon | chromosome |
| Accession | NZ_LR778141 | ||
| Organism | Escherichia coli isolate SC407 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | H1C92_RS14045 | Protein ID | WP_115425318.1 |
| Coordinates | 2869779..2870156 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | H1C92_RS14050 | Protein ID | WP_115437919.1 |
| Coordinates | 2870203..2870577 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C92_RS14015 | 2865429..2867270 | + | 1842 | WP_000437371.1 | RNA polymerase sigma factor RpoD | - |
| H1C92_RS14020 | 2867349..2867855 | - | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
| H1C92_RS14030 | 2868155..2869000 | - | 846 | WP_115425319.1 | DUF4942 domain-containing protein | - |
| H1C92_RS14035 | 2869085..2869282 | - | 198 | WP_115425317.1 | DUF957 domain-containing protein | - |
| H1C92_RS14040 | 2869294..2869782 | - | 489 | WP_059252050.1 | hypothetical protein | - |
| H1C92_RS14045 | 2869779..2870156 | - | 378 | WP_115425318.1 | TA system toxin CbtA family protein | Toxin |
| H1C92_RS14050 | 2870203..2870577 | - | 375 | WP_115437919.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| H1C92_RS14055 | 2870740..2870961 | - | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| H1C92_RS14060 | 2871030..2871506 | - | 477 | WP_086325469.1 | RadC family protein | - |
| H1C92_RS14065 | 2871522..2872007 | - | 486 | WP_174490833.1 | antirestriction protein | - |
| H1C92_RS14070 | 2872099..2872917 | - | 819 | Protein_2749 | DUF945 domain-containing protein | - |
| H1C92_RS14075 | 2873240..2873758 | - | 519 | WP_115425212.1 | hypothetical protein | - |
| H1C92_RS14080 | 2873777..2874016 | - | 240 | WP_001255978.1 | hypothetical protein | - |
| H1C92_RS14090 | 2874203..2874427 | - | 225 | WP_115425211.1 | hypothetical protein | - |
| H1C92_RS14095 | 2874503..2874709 | - | 207 | WP_000668905.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14173.15 Da Isoelectric Point: 6.9576
>T289100 WP_115425318.1 NZ_LR778141:c2870156-2869779 [Escherichia coli]
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNDITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13845.63 Da Isoelectric Point: 6.4764
>AT289100 WP_115437919.1 NZ_LR778141:c2870577-2870203 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRADIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|