Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2149074..2149699 | Replicon | chromosome |
Accession | NZ_LR778141 | ||
Organism | Escherichia coli isolate SC407 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | H1C92_RS10670 | Protein ID | WP_000911330.1 |
Coordinates | 2149074..2149472 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | H1C92_RS10675 | Protein ID | WP_000450524.1 |
Coordinates | 2149472..2149699 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C92_RS10650 | 2144952..2145152 | + | 201 | WP_000383836.1 | YpfN family protein | - |
H1C92_RS10655 | 2145262..2145960 | - | 699 | WP_000679823.1 | esterase | - |
H1C92_RS10660 | 2146034..2148049 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
H1C92_RS10665 | 2148064..2148927 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
H1C92_RS10670 | 2149074..2149472 | - | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
H1C92_RS10675 | 2149472..2149699 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
H1C92_RS10680 | 2149853..2150566 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
H1C92_RS10685 | 2150779..2151813 | - | 1035 | WP_001358397.1 | outer membrane protein assembly factor BamC | - |
H1C92_RS10690 | 2151830..2152708 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
H1C92_RS10695 | 2152854..2153426 | + | 573 | WP_000176191.1 | glycine cleavage system transcriptional repressor | - |
H1C92_RS10700 | 2153426..2153896 | + | 471 | WP_001068677.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T289096 WP_000911330.1 NZ_LR778141:c2149472-2149074 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|