Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1184321..1184847 | Replicon | chromosome |
| Accession | NZ_LR778141 | ||
| Organism | Escherichia coli isolate SC407 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | H1C92_RS05935 | Protein ID | WP_000323025.1 |
| Coordinates | 1184321..1184608 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | H1C92_RS05940 | Protein ID | WP_000534858.1 |
| Coordinates | 1184608..1184847 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C92_RS05895 | 1179604..1179819 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
| H1C92_RS05900 | 1180573..1180788 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| H1C92_RS05905 | 1181087..1181289 | + | 203 | Protein_1154 | cold shock-like protein CspF | - |
| H1C92_RS05910 | 1181464..1182216 | - | 753 | WP_001047131.1 | antitermination protein | - |
| H1C92_RS05915 | 1182230..1183279 | - | 1050 | WP_001265196.1 | DUF968 domain-containing protein | - |
| H1C92_RS05920 | 1183281..1183559 | - | 279 | WP_023140913.1 | hypothetical protein | - |
| H1C92_RS05925 | 1183626..1183877 | - | 252 | WP_000980999.1 | hypothetical protein | - |
| H1C92_RS05930 | 1184094..1184249 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| H1C92_RS05935 | 1184321..1184608 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| H1C92_RS05940 | 1184608..1184847 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| H1C92_RS05945 | 1184872..1185177 | + | 306 | WP_001326990.1 | hypothetical protein | - |
| H1C92_RS05950 | 1185380..1185712 | + | 333 | WP_001349760.1 | FlxA-like family protein | - |
| H1C92_RS05955 | 1186149..1187489 | - | 1341 | WP_000589013.1 | ISNCY family transposase | - |
| H1C92_RS05960 | 1188258..1188544 | - | 287 | Protein_1165 | hypothetical protein | - |
| H1C92_RS24660 | 1188710..1188892 | - | 183 | Protein_1166 | hypothetical protein | - |
| H1C92_RS05965 | 1189155..1189511 | - | 357 | WP_001315552.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1148861..1199194 | 50333 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T289090 WP_000323025.1 NZ_LR778141:c1184608-1184321 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|