Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1008531..1009169 | Replicon | chromosome |
Accession | NZ_LR778141 | ||
Organism | Escherichia coli isolate SC407 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | H1C92_RS05095 | Protein ID | WP_000813794.1 |
Coordinates | 1008531..1008707 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | H1C92_RS05100 | Protein ID | WP_001270285.1 |
Coordinates | 1008753..1009169 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C92_RS05075 | 1004150..1005364 | - | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
H1C92_RS05080 | 1005417..1005953 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
H1C92_RS05085 | 1006026..1007987 | + | 1962 | Protein_991 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
H1C92_RS05090 | 1008079..1008309 | - | 231 | WP_000494244.1 | YncJ family protein | - |
H1C92_RS05095 | 1008531..1008707 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
H1C92_RS05100 | 1008753..1009169 | + | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
H1C92_RS05105 | 1009248..1010654 | + | 1407 | WP_000760594.1 | PLP-dependent aminotransferase family protein | - |
H1C92_RS05110 | 1010899..1012044 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
H1C92_RS05115 | 1012062..1013075 | + | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
H1C92_RS05120 | 1013076..1014017 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1002962..1004110 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T289089 WP_000813794.1 NZ_LR778141:1008531-1008707 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT289089 WP_001270285.1 NZ_LR778141:1008753-1009169 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|