Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 806227..806705 Replicon chromosome
Accession NZ_LR778141
Organism Escherichia coli isolate SC407

Toxin (Protein)


Gene name parE_1 Uniprot ID A0A7D8WGY6
Locus tag H1C92_RS04005 Protein ID WP_000936798.1
Coordinates 806227..806514 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID A0A7D8X397
Locus tag H1C92_RS04010 Protein ID WP_024207685.1
Coordinates 806514..806705 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H1C92_RS03970 801648..801896 - 249 WP_000113182.1 excisionase -
H1C92_RS03975 801961..804432 - 2472 WP_115425220.1 exonuclease -
H1C92_RS03980 804513..804716 - 204 WP_001090192.1 DUF1482 family protein -
H1C92_RS03985 804719..804901 - 183 WP_000449182.1 cell division inhibition protein DicB -
H1C92_RS03990 805474..805659 + 186 WP_001305873.1 hypothetical protein -
H1C92_RS03995 805631..805789 - 159 WP_021562152.1 hypothetical protein -
H1C92_RS04000 805801..805953 - 153 WP_115425312.1 DUF1391 family protein -
H1C92_RS04005 806227..806514 - 288 WP_000936798.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
H1C92_RS04010 806514..806705 - 192 WP_024207685.1 hypothetical protein Antitoxin
H1C92_RS04015 806733..807134 - 402 WP_001329851.1 helix-turn-helix domain-containing protein -
H1C92_RS04020 807244..807516 + 273 WP_024207686.1 helix-turn-helix domain-containing protein -
H1C92_RS04025 807500..808021 + 522 WP_115425301.1 hypothetical protein -
H1C92_RS04030 808002..808967 + 966 WP_122989178.1 hypothetical protein -
H1C92_RS04035 808974..809720 + 747 WP_000788975.1 ATP-binding protein -
H1C92_RS04040 809743..810495 + 753 WP_115425302.1 DUF1627 domain-containing protein -
H1C92_RS04045 810482..810943 + 462 WP_115425303.1 ead/Ea22-like family protein -
H1C92_RS04050 811039..811221 + 183 WP_115425304.1 hypothetical protein -
H1C92_RS04055 811214..811390 + 177 WP_000753067.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 796405..848579 52174


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10899.83 Da        Isoelectric Point: 10.1360

>T289088 WP_000936798.1 NZ_LR778141:c806514-806227 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVAASSIE
IANIVHARRQFPFPI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7017.77 Da        Isoelectric Point: 4.0270

>AT289088 WP_024207685.1 NZ_LR778141:c806705-806514 [Escherichia coli]
MSTALSPIVSEFETTEQENSYNEWLRAKVASSLADPRPSIPHDEVMAEIENLIAQIAVTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D8WGY6

Antitoxin

Source ID Structure
AlphaFold DB A0A7D8X397

References