Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2588358..2588996 | Replicon | chromosome |
Accession | NZ_LR778140 | ||
Organism | Escherichia coli isolate SC406 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | H1C94_RS12340 | Protein ID | WP_000813794.1 |
Coordinates | 2588820..2588996 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | H1C94_RS12335 | Protein ID | WP_001270285.1 |
Coordinates | 2588358..2588774 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C94_RS12315 | 2583510..2584451 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
H1C94_RS12320 | 2584452..2585465 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
H1C94_RS12325 | 2585483..2586628 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
H1C94_RS12330 | 2586873..2588279 | - | 1407 | WP_000760594.1 | PLP-dependent aminotransferase family protein | - |
H1C94_RS12335 | 2588358..2588774 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
H1C94_RS12340 | 2588820..2588996 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
H1C94_RS12345 | 2589218..2589448 | + | 231 | WP_000494244.1 | YncJ family protein | - |
H1C94_RS12350 | 2589540..2591501 | - | 1962 | Protein_2415 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
H1C94_RS12355 | 2591574..2592110 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
H1C94_RS12360 | 2592163..2593377 | + | 1215 | WP_001326689.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2593417..2594565 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T289074 WP_000813794.1 NZ_LR778140:c2588996-2588820 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT289074 WP_001270285.1 NZ_LR778140:c2588774-2588358 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|