Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1489311..1489936 | Replicon | chromosome |
Accession | NZ_LR778140 | ||
Organism | Escherichia coli isolate SC406 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | H1C94_RS07070 | Protein ID | WP_000911330.1 |
Coordinates | 1489538..1489936 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | H1C94_RS07065 | Protein ID | WP_000450524.1 |
Coordinates | 1489311..1489538 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H1C94_RS07040 | 1485114..1485584 | - | 471 | WP_001068677.1 | thioredoxin-dependent thiol peroxidase | - |
H1C94_RS07045 | 1485584..1486156 | - | 573 | WP_000176191.1 | glycine cleavage system transcriptional repressor | - |
H1C94_RS07050 | 1486302..1487180 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
H1C94_RS07055 | 1487197..1488231 | + | 1035 | WP_001358397.1 | outer membrane protein assembly factor BamC | - |
H1C94_RS07060 | 1488444..1489157 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
H1C94_RS07065 | 1489311..1489538 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
H1C94_RS07070 | 1489538..1489936 | + | 399 | WP_000911330.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
H1C94_RS07075 | 1490083..1490946 | + | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
H1C94_RS07080 | 1490961..1492976 | + | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
H1C94_RS07085 | 1493050..1493748 | + | 699 | WP_000679823.1 | esterase | - |
H1C94_RS07090 | 1493858..1494058 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T289067 WP_000911330.1 NZ_LR778140:1489538-1489936 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|