Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 399505..400305 | Replicon | chromosome |
| Accession | NZ_LR778140 | ||
| Organism | Escherichia coli isolate SC406 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | F4NNI0 |
| Locus tag | H1C94_RS01835 | Protein ID | WP_000342449.1 |
| Coordinates | 399778..400305 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | H1C94_RS01830 | Protein ID | WP_001277108.1 |
| Coordinates | 399505..399771 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H1C94_RS01810 | 395163..395831 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
| H1C94_RS01815 | 395824..396882 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| H1C94_RS01820 | 397127..397981 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| H1C94_RS01825 | 398252..399355 | + | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| H1C94_RS01830 | 399505..399771 | + | 267 | WP_001277108.1 | DUF1778 domain-containing protein | Antitoxin |
| H1C94_RS01835 | 399778..400305 | + | 528 | WP_000342449.1 | GNAT family N-acetyltransferase | Toxin |
| H1C94_RS01840 | 400302..400685 | - | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| H1C94_RS01845 | 401109..402218 | + | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| H1C94_RS01850 | 402266..403192 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| H1C94_RS01855 | 403189..404466 | + | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
| H1C94_RS01860 | 404463..405230 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19691.70 Da Isoelectric Point: 7.7457
>T289062 WP_000342449.1 NZ_LR778140:399778-400305 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CLZ4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6GTS | |
| PDB | 6AJN | |
| PDB | 6GTQ | |
| PDB | 6GTO | |
| PDB | 6GTR | |
| PDB | 6AJM | |
| AlphaFold DB | A0A829CN24 |