Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemK-mazE/MazF(toxin) |
Location | 1475138..1475763 | Replicon | chromosome |
Accession | NZ_LR746496 | ||
Organism | Acididesulfobacillus acetoxydans isolate PacBioINE |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | MNU25_RS06530 | Protein ID | WP_045574608.1 |
Coordinates | 1475413..1475763 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | MNU25_RS06525 | Protein ID | WP_240984334.1 |
Coordinates | 1475138..1475413 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MNU25_RS06505 (DEACI_1344) | 1470868..1471608 | + | 741 | WP_240984330.1 | hypothetical protein | - |
MNU25_RS06510 (DEACI_1345) | 1471670..1471921 | + | 252 | WP_240984331.1 | hypothetical protein | - |
MNU25_RS06515 (DEACI_1346) | 1472317..1473765 | + | 1449 | WP_240984332.1 | Mur ligase family protein | - |
MNU25_RS06520 (DEACI_1347) | 1473762..1474667 | + | 906 | WP_240984333.1 | glutamine amidotransferase | - |
MNU25_RS06525 (DEACI_1348) | 1475138..1475413 | + | 276 | WP_240984334.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MNU25_RS06530 (DEACI_1349) | 1475413..1475763 | + | 351 | WP_045574608.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
MNU25_RS06535 (DEACI_1350) | 1476043..1476465 | + | 423 | WP_240984335.1 | PaaI family thioesterase | - |
MNU25_RS06540 (DEACI_1351) | 1476577..1477296 | + | 720 | WP_240984336.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
MNU25_RS06545 (DEACI_1354) | 1478021..1479322 | + | 1302 | WP_240984337.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12794.84 Da Isoelectric Point: 5.8944
>T289057 WP_045574608.1 NZ_LR746496:1475413-1475763 [Acididesulfobacillus acetoxydans]
MIIKRGEIYYAELNPVVGSEQGGTRPVLVIQNDIGNQFSPTTIIAAITSQIAKAKLPTHVEVRAKRSGLERDSVILTEQI
RTIDKSRLKEKVAVLDEEVMLRVDQAIEISLGLADI
MIIKRGEIYYAELNPVVGSEQGGTRPVLVIQNDIGNQFSPTTIIAAITSQIAKAKLPTHVEVRAKRSGLERDSVILTEQI
RTIDKSRLKEKVAVLDEEVMLRVDQAIEISLGLADI
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|