Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 184983..185632 | Replicon | chromosome |
| Accession | NZ_LR746496 | ||
| Organism | Acididesulfobacillus acetoxydans isolate PacBioINE | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | MNU25_RS00815 | Protein ID | WP_240983337.1 |
| Coordinates | 184983..185405 (-) | Length | 141 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | MNU25_RS00820 | Protein ID | WP_240983338.1 |
| Coordinates | 185402..185632 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MNU25_RS00790 (DEACI_0161) | 180624..181376 | - | 753 | WP_240983333.1 | 5-oxoprolinase subunit PxpA | - |
| MNU25_RS00795 | 181948..182058 | - | 111 | Protein_154 | hypothetical protein | - |
| MNU25_RS00800 (DEACI_0163) | 182075..183283 | - | 1209 | WP_240983334.1 | threonine ammonia-lyase | - |
| MNU25_RS00805 (DEACI_0164) | 183300..183689 | - | 390 | WP_277350653.1 | RidA family protein | - |
| MNU25_RS00810 (DEACI_0165) | 183854..184750 | - | 897 | WP_240983336.1 | transcriptional regulator | - |
| MNU25_RS00815 (DEACI_0166) | 184983..185405 | - | 423 | WP_240983337.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| MNU25_RS00820 (DEACI_0167) | 185402..185632 | - | 231 | WP_240983338.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| MNU25_RS00825 (DEACI_0168) | 185824..185997 | - | 174 | Protein_160 | DUF979 family protein | - |
| MNU25_RS00830 (DEACI_0169) | 185982..186392 | - | 411 | WP_240983339.1 | DUF969 family protein | - |
| MNU25_RS00835 (DEACI_0170) | 186380..187324 | - | 945 | WP_261487033.1 | biotin-dependent carboxyltransferase family protein | - |
| MNU25_RS00840 (DEACI_0171) | 187339..188043 | - | 705 | WP_240983341.1 | 5-oxoprolinase subunit PxpB | - |
| MNU25_RS00845 (DEACI_0173) | 188371..189141 | - | 771 | WP_240983342.1 | HD-GYP domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 141 a.a. Molecular weight: 15422.92 Da Isoelectric Point: 5.6159
>T289056 WP_240983337.1 NZ_LR746496:c185405-184983 [Acididesulfobacillus acetoxydans]
MKYMLDTNICVYLIKKKPENVLITLHSNMGDGVAISAITLAELMHGVEASAYPERNALALNQFLSITDILPFDHEAAAEY
GKICAALRRRGIPIGAMDMLIAAHAKAKGLIVVTNNVREFERVEGLEVENWVSENKPSDL
MKYMLDTNICVYLIKKKPENVLITLHSNMGDGVAISAITLAELMHGVEASAYPERNALALNQFLSITDILPFDHEAAAEY
GKICAALRRRGIPIGAMDMLIAAHAKAKGLIVVTNNVREFERVEGLEVENWVSENKPSDL
Download Length: 423 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|