289055

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 153462..154132 Replicon plasmid pVIR_Kpn2166
Accession NZ_LR745046
Organism Klebsiella pneumoniae isolate Kpn2166

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag GWJ69_RS27020 Protein ID WP_004213072.1
Coordinates 153462..153905 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag GWJ69_RS27025 Protein ID WP_004213073.1
Coordinates 153902..154132 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GWJ69_RS26990 148867..149142 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
GWJ69_RS26995 149205..149696 + 492 WP_011251327.1 DM13 domain-containing protein -
GWJ69_RS27000 149745..150665 + 921 WP_004213934.1 DUF1471 domain-containing protein -
GWJ69_RS27005 150756..151162 + 407 Protein_160 GAF domain-containing protein -
GWJ69_RS28125 151677..152318 - 642 Protein_161 response regulator -
GWJ69_RS27010 152735..153028 + 294 Protein_162 transposase -
GWJ69_RS27015 153032..153448 + 417 Protein_163 restriction endonuclease -
GWJ69_RS27020 153462..153905 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
GWJ69_RS27025 153902..154132 - 231 WP_004213073.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
GWJ69_RS27030 154740..155873 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
GWJ69_RS27035 155889..156182 + 294 WP_004213076.1 hypothetical protein -
GWJ69_RS27040 156172..156378 - 207 WP_004213077.1 hypothetical protein -
GWJ69_RS27045 156730..157020 + 291 WP_004213078.1 hypothetical protein -
GWJ69_RS27050 157010..157909 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 1..226671 226671


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T289055 WP_004213072.1 NZ_LR745046:c153905-153462 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT289055 WP_004213073.1 NZ_LR745046:c154132-153902 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References