Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 87951..88687 | Replicon | plasmid pVIR_Kpn2166 |
Accession | NZ_LR745046 | ||
Organism | Klebsiella pneumoniae isolate Kpn2166 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J5Q928 |
Locus tag | GWJ69_RS26690 | Protein ID | WP_004098919.1 |
Coordinates | 87951..88433 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
Locus tag | GWJ69_RS26695 | Protein ID | WP_004213599.1 |
Coordinates | 88421..88687 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GWJ69_RS26670 | 83528..84874 | + | 1347 | WP_011154555.1 | dihydroorotase | - |
GWJ69_RS26675 | 84938..85737 | + | 800 | Protein_94 | hypothetical protein | - |
GWJ69_RS26680 | 85912..86307 | + | 396 | Protein_95 | DDE-type integrase/transposase/recombinase | - |
GWJ69_RS26685 | 86303..87530 | - | 1228 | Protein_96 | IS3 family transposase | - |
GWJ69_RS26690 | 87951..88433 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
GWJ69_RS26695 | 88421..88687 | - | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
GWJ69_RS26700 | 88882..89112 | - | 231 | WP_004213598.1 | hypothetical protein | - |
GWJ69_RS26705 | 89126..89329 | - | 204 | WP_004213596.1 | hemolysin expression modulator Hha | - |
GWJ69_RS26710 | 89390..89884 | - | 495 | WP_004213594.1 | hypothetical protein | - |
GWJ69_RS26715 | 89926..92895 | - | 2970 | WP_004213592.1 | Tn3 family transposase | - |
GWJ69_RS26720 | 92898..93455 | - | 558 | WP_004213590.1 | recombinase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 | 1..226671 | 226671 | |
- | inside | IScluster/Tn | - | - | 86303..93455 | 7152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T289054 WP_004098919.1 NZ_LR745046:c88433-87951 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J5Q928 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D3T1D0 |