Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4767979..4768495 | Replicon | chromosome |
| Accession | NZ_LR745045 | ||
| Organism | Klebsiella pneumoniae isolate Kpn2166 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | GWJ69_RS23515 | Protein ID | WP_004178374.1 |
| Coordinates | 4767979..4768263 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | GWJ69_RS23520 | Protein ID | WP_002886901.1 |
| Coordinates | 4768253..4768495 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GWJ69_RS23490 | 4763462..4763770 | - | 309 | WP_004210629.1 | PTS sugar transporter subunit IIB | - |
| GWJ69_RS23495 | 4763855..4764028 | + | 174 | WP_004210630.1 | hypothetical protein | - |
| GWJ69_RS23500 | 4764031..4764774 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| GWJ69_RS23505 | 4765131..4767269 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| GWJ69_RS23510 | 4767511..4767975 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| GWJ69_RS23515 | 4767979..4768263 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| GWJ69_RS23520 | 4768253..4768495 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| GWJ69_RS23525 | 4768573..4770483 | - | 1911 | WP_004152270.1 | BglG family transcription antiterminator | - |
| GWJ69_RS23530 | 4770506..4771660 | - | 1155 | WP_004210635.1 | lactonase family protein | - |
| GWJ69_RS23535 | 4771727..4772467 | - | 741 | WP_004186692.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T289051 WP_004178374.1 NZ_LR745045:c4768263-4767979 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6THG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |